PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G1167
Common NameMYB3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 193aa    MW: 22534.4 Da    PI: 10.0001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G1167genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.2e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+++++ +G ++WktI++  g++R++k+c++rw +yl
      Gh_A05G1167 14 KGAWTAEEDRKLAEVITVHGAKRWKTIPSIAGLNRCGKSCRLRWMNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.93.7e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
      Gh_A05G1167  67 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 112
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.448965IPR017930Myb domain
SuperFamilySSF466892.37E-2911108IPR009057Homeodomain-like
SMARTSM007172.7E-141363IPR001005SANT/Myb domain
PfamPF002491.6E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-241568IPR009057Homeodomain-like
CDDcd001679.64E-101661No hitNo description
PROSITE profilePS5129420.66566116IPR017930Myb domain
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PfamPF002491.5E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2569117IPR009057Homeodomain-like
CDDcd001676.58E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090378Biological Processseed trichome elongation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MEQNLSLKRF DVNKGAWTAE EDRKLAEVIT VHGAKRWKTI PSIAGLNRCG KSCRLRWMNY  60
LRPNIKRGNI SDQEEDLILR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNS HLSKKVNQKE  120
KHRGASARQG CKFAQQRLVE NAKEQVREEN TSTGFGESNI SFDVDDFFDF SNVDTRNFEW  180
VNRFLEVDDG FKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29111174109B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.80870.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0341310.0AF034131.1 Gossypium hirsutum MYB-like DNA-binding domain protein (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447716.11e-128PREDICTED: transcription factor MYB114-like
SwissprotQ9FJA21e-52TT2_ARATH; Transcription factor TT2
TrEMBLO490181e-142O49018_G
TrEMBLA0A0B0NG511e-142A0A0B0NG51_G
STRINGPOPTR_0001s16970.14e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-53MYB family protein
Publications ? help Back to Top
  1. Loguerico LL,Zhang JQ,Wilkins TA
    Differential regulation of six novel MYB-domain genes defines two distinct expression patterns in allotetraploid cotton (Gossypium hirsutum L.).
    Mol. Gen. Genet., 1999. 261(4-5): p. 660-71
    [PMID:10394903]